SCOPe 2.07: Domain d4w1xa_: 4w1x A:

Lineage for d4w1xa_ (4w1x A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (160 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [225404] (30 PDB entries)

8. Domain d4w1xa_: 4w1x A: [309778]
   automated match to d4cxqa_
   complexed with 3g9, edo, peg, plp

Details for d4w1xa_

PDB Entry: 4w1x, 1.8 Å

PDB Description: crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with 1-(4-(4-(3-chlorobenzoyl) piperazin-1-yl)phenyl)ethanone

PDB Compounds: (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase

SCOPe Domain Sequences for d4w1xa_:

Sequence; same for both SEQRES and ATOM records:

>d4w1xa_ c.67.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
ltpeqiiavdgahlwhpyssigreavspvvavaahgawltlirdgqpievldamsswwta
ihghghpaldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvffsdsgsvs
vevaakmalqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhslwtdvlaaqvf
apqvprdydpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdlrdicrry
evllifdeiatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctadvahtisa
gaagalmhgptfmanplacavsvasvelllgqdwrtritelaagltagldtaralpavtd
vrvcgaigviecdrpvdlavatpaaldrgvwlrpfrnlvyamppyictpaeitqitsamv
evarlvgsl

Timeline for d4w1xa_:

• d4w1xa_ first appeared in SCOPe 2.06
  
• d4w1xa_ appears in the current release, SCOPe 2.08