SCOPe 2.08: Domain d4uz2a1: 4uz2 A:16-62

Lineage for d4uz2a1 (4uz2 A:16-62)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.7: LysM domain [54105] (1 superfamily)
   beta-alpha(2)-beta; antiparallel strands

4. Superfamily d.7.1: LysM domain [54106] (2 families)
   automatically mapped to Pfam PF01476

5. Family d.7.1.0: automated matches [234000] (1 protein)
   not a true family

6. Protein automated matches [234001] (7 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [268982] (2 PDB entries)

8. Domain d4uz2a1: 4uz2 A:16-62 [309764]
   automated match to d4uz3c_

Details for d4uz2a1

PDB Entry: 4uz2, 2.5 Å

PDB Description: crystal structure of the n-terminal lysm domains from the putative nlpc/p60 d,l endopeptidase from t. thermophilus

PDB Compounds: (A:) cell wall-binding endopeptidase-related protein

SCOPe Domain Sequences for d4uz2a1:

Sequence; same for both SEQRES and ATOM records:

>d4uz2a1 d.7.1.0 (A:16-62) automated matches {Thermus thermophilus [TaxId: 300852]}
qatytvapgdtlysiarrygttveelmrlnglesfllqpgqvlklps

Timeline for d4uz2a1:

• d4uz2a1 first appeared in SCOPe 2.06
  
• d4uz2a1 appears in SCOPe 2.07