Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.7: LysM domain [54105] (1 superfamily) beta-alpha(2)-beta; antiparallel strands |
Superfamily d.7.1: LysM domain [54106] (2 families) automatically mapped to Pfam PF01476 |
Family d.7.1.0: automated matches [234000] (1 protein) not a true family |
Protein automated matches [234001] (7 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [268982] (2 PDB entries) |
Domain d4uz2a1: 4uz2 A:16-62 [309764] automated match to d4uz3c_ |
PDB Entry: 4uz2 (more details), 2.5 Å
SCOPe Domain Sequences for d4uz2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uz2a1 d.7.1.0 (A:16-62) automated matches {Thermus thermophilus [TaxId: 300852]} qatytvapgdtlysiarrygttveelmrlnglesfllqpgqvlklps
Timeline for d4uz2a1: