SCOPe 2.06: Domain d4uyof_: 4uyo F:

Lineage for d4uyof_ (4uyo F:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.62: Diacylglycerol kinase (DgkA)-like [310569] (1 superfamily)
   forms homotrimer; each monomer has 3 transmembrane helices and one amphiphilic helix

4. Superfamily f.62.1: Diacylglycerol kinase (DgkA)-like [310600] (1 family)
   Pfam PF01219

5. Family f.62.1.1: Diacylglycerol kinase (DgkA)-like [310650] (2 proteins)

6. Protein Diacylglycerol kinase (DgkA) [310803] (1 species)

7. Species Escherichia coli K-12 [TaxId:83333] [311068] (11 PDB entries)

8. Domain d4uyof_: 4uyo F: [309763]
   automated match to d3ze3a_
   complexed with 79m, 79n, flc, zn

Details for d4uyof_

PDB Entry: 4uyo, 2.18 Å

PDB Description: structure of delta7-dgka in 7.9 mag by serial femtosecond crystatallography to 2.18 angstrom resolution

PDB Compounds: (F:) diacylglycerol kinase-delta 7

SCOPe Domain Sequences for d4uyof_:

Sequence; same for both SEQRES and ATOM records:

>d4uyof_ f.62.1.1 (F:) Diacylglycerol kinase (DgkA) {Escherichia coli K-12 [TaxId: 83333]}
ineaafrqegvavllcvviaawldvdavtrvllissvmlvmivellnsaieavvdrigse
yhelsgrakdlgsaavliaiidavitwaillwshf

Timeline for d4uyof_:

• d4uyof_ is new in SCOPe 2.06-stable
  
• d4uyof_ appears in SCOPe 2.07
  
• d4uyof_ appears in the current release, SCOPe 2.08