Lineage for d4uljh_ (4ulj h:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808917Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2809156Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2809157Protein automated matches [190568] (11 species)
    not a true protein
  7. 2809172Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267880] (22 PDB entries)
  8. 2809197Domain d4uljh_: 4ulj h: [309739]
    automated match to d3frxd_
    protein/RNA complex; complexed with mg, ohx, zn

Details for d4uljh_

PDB Entry: 4ulj (more details), 3.1 Å

PDB Description: Crystal structure of Phyllanthoside bound to the yeast 80S ribosome
PDB Compounds: (h:) Guanine nucleotide-binding protein subunit beta-like protein

SCOPe Domain Sequences for d4uljh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uljh_ b.69.4.0 (h:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
asnevlvlrgtleghngwvtslatsagqpnlllsasrdktliswkltgddqkfgvpvrsf
kghshivqdctltadgayalsaswdktlrlwdvatgetyqrfvghksdvmsvdidkkasm
iisgsrdktikvwtikgqclatllghndwvsqvrvvpnekadddsvtiisagndkmvkaw
nlnqfqieadfighnsnintltaspdgtliasagkdgeimlwnlaakkamytlsaqdevf
slafspnrywlaaatatgikvfsldpqylvddlrpefagyskaaephavslawsadgqtl
fagytdnvirvwqvmtan

SCOPe Domain Coordinates for d4uljh_:

Click to download the PDB-style file with coordinates for d4uljh_.
(The format of our PDB-style files is described here.)

Timeline for d4uljh_: