Lineage for d4uade_ (4uad E:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2567595Fold d.361: PB2 C-terminal domain-like [160452] (1 superfamily)
    alpha-beta-alpha-X-alpha-beta(2); 3 layers, a/b/a; antiparallel beta-sheet, order 132; connection between helices 2 and 3 runs over the edge of the beta-sheet
  4. 2567596Superfamily d.361.1: PB2 C-terminal domain-like [160453] (1 family) (S)
    automatically mapped to Pfam PF00604
  5. 2567597Family d.361.1.1: PB2 C-terminal domain-like [160454] (2 proteins)
    C-terminal part of Pfam PF00604
  6. 2567598Protein Polymerase basic protein 2, BP2 [160455] (1 species)
  7. 2567599Species Influenza A virus, different strains [TaxId:11320] [160456] (4 PDB entries)
    Uniprot P31345 685-759
  8. 2567601Domain d4uade_: 4uad E: [309698]
    Other proteins in same PDB: d4uada_
    automated match to d2gmoa1

Details for d4uade_

PDB Entry: 4uad (more details), 2.42 Å

PDB Description: importin alpha 7 delta ibb in complex with influenza pb2 nuclear localization domain
PDB Compounds: (E:) Polymerase basic protein 2

SCOPe Domain Sequences for d4uade_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uade_ d.361.1.1 (E:) Polymerase basic protein 2, BP2 {Influenza A virus, different strains [TaxId: 11320]}
tsgvesavlrgflilgkedrrygpalsinelsnlakgekanvligqgdvvlvmkrkrdss
iltdsqtatkrirma

SCOPe Domain Coordinates for d4uade_:

Click to download the PDB-style file with coordinates for d4uade_.
(The format of our PDB-style files is described here.)

Timeline for d4uade_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4uada_