Lineage for d4tswf_ (4tsw F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777173Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2777391Protein Tumor necrosis factor (TNF) [49848] (3 species)
  7. 2777392Species Human (Homo sapiens) [TaxId:9606] [49849] (33 PDB entries)
  8. 2777420Domain d4tswf_: 4tsw F: [309669]
    automated match to d5tswa_
    mutant

Details for d4tswf_

PDB Entry: 4tsw (more details), 2.5 Å

PDB Description: high resolution crystal structure of a human tnf-alpha mutant
PDB Compounds: (F:) tumor necrosis factor-alpha

SCOPe Domain Sequences for d4tswf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tswf_ b.22.1.1 (F:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]}
sdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgqg
cpsthvllthtisriavsyqtkvnllsaikspcqrtpegaeakpwyepiylggvfqlekg
drlsaeinrpdyldfaesgqvyfgiial

SCOPe Domain Coordinates for d4tswf_:

Click to download the PDB-style file with coordinates for d4tswf_.
(The format of our PDB-style files is described here.)

Timeline for d4tswf_: