SCOPe 2.08: Domain d4tmcb_: 4tmc B:

Lineage for d4tmcb_ (4tmc B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)

6. Protein automated matches [190228] (20 species)
   not a true protein

7. Species Kluyveromyces marxianus [TaxId:4911] [311442] (2 PDB entries)

8. Domain d4tmcb_: 4tmc B: [309660]
   automated match to d3tx9a_
   complexed with fmn, hba

Details for d4tmcb_

PDB Entry: 4tmc, 1.8 Å

PDB Description: crystal structure of old yellow enzyme from candida macedoniensis aku4588 complexed with p-hydroxybenzaldehyde

PDB Compounds: (B:) old yellow enzyme

SCOPe Domain Sequences for d4tmcb_:

Sequence; same for both SEQRES and ATOM records:

>d4tmcb_ c.1.4.1 (B:) automated matches {Kluyveromyces marxianus [TaxId: 4911]}
msymnfdpkplgdtnifkpikignnelkhrvvmpaltrmraiapgnipntewaeeyyrqr
sqypgtliitegtfpsaqsggypnvpgiwskeqlaewkkifnaihenksfvwvqlwvlgr
qawpevlkkeglrydsatddlymgeeekeralkannpqhgitkeeikqyikeyvdaakka
idagadgvqihsangyllnqfldpisnnrtdeyggsienrarftlevvdavvdavgaert
sirfspygtfgtmsggenpgivaqyayvigelekraragkrlafidlveprvtdpflpef
ekwfkegtnefiysiwkgpvlrvgnyaldpdqatldskkpntligygrsfianpdlvyrl
ekglplnkydrntfytftkegytdypsyeesvakgykk

Timeline for d4tmcb_:

• d4tmcb_ first appeared in SCOPe 2.06
  
• d4tmcb_ appears in SCOPe 2.07