SCOPe 2.08: Domain d4rv6c2: 4rv6 C:797-1010

Lineage for d4rv6c2 (4rv6 C:797-1010)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225406] (56 PDB entries)

8. Domain d4rv6c2: 4rv6 C:797-1010 [309583]
   Other proteins in same PDB: d4rv6a1, d4rv6b1, d4rv6c1, d4rv6d1
   automated match to d4hhyd2
   complexed with rpb, so4

Details for d4rv6c2

PDB Entry: 4rv6, 3.19 Å

PDB Description: human artd1 (parp1) catalytic domain in complex with inhibitor rucaparib

PDB Compounds: (C:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4rv6c2:

Sequence; same for both SEQRES and ATOM records:

>d4rv6c2 d.166.1.0 (C:797-1010) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfk

Timeline for d4rv6c2:

• d4rv6c2 first appeared in SCOPe 2.06
  
• d4rv6c2 appears in SCOPe 2.07