![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
![]() | Protein automated matches [190233] (22 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187090] (78 PDB entries) |
![]() | Domain d4rmab1: 4rma B:2-87 [309473] Other proteins in same PDB: d4rmaa2, d4rmaa3, d4rmab2, d4rmab3 automated match to d1gc7a3 complexed with so4 |
PDB Entry: 4rma (more details), 1.75 Å
SCOPe Domain Sequences for d4rmab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rmab1 d.15.1.0 (B:2-87) automated matches {Human (Homo sapiens) [TaxId: 9606]} pkpinvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwyfglhyvdnkgfptwlkl dkkvsaqevrkenplqfkfrakfype
Timeline for d4rmab1: