SCOPe 2.06: Domain d4rmab1: 4rma B:2-87

Lineage for d4rmab1 (4rma B:2-87)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (78 PDB entries)

8. Domain d4rmab1: 4rma B:2-87 [309473]
   Other proteins in same PDB: d4rmaa2, d4rmaa3, d4rmab2, d4rmab3
   automated match to d1gc7a3
   complexed with so4

Details for d4rmab1

PDB Entry: 4rma, 1.75 Å

PDB Description: crystal structure of the ferm domain of human ezrin

PDB Compounds: (B:) Ezrin

SCOPe Domain Sequences for d4rmab1:

Sequence; same for both SEQRES and ATOM records:

>d4rmab1 d.15.1.0 (B:2-87) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkpinvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwyfglhyvdnkgfptwlkl
dkkvsaqevrkenplqfkfrakfype

Timeline for d4rmab1:

• d4rmab1 is new in SCOPe 2.06-stable
  
• d4rmab1 appears in SCOPe 2.07
  
• d4rmab1 appears in the current release, SCOPe 2.08