SCOPe 2.06: Domain d4rmaa3: 4rma A:199-296

Lineage for d4rmaa3 (4rma A:199-296)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (54 PDB entries)

8. Domain d4rmaa3: 4rma A:199-296 [309472]
   Other proteins in same PDB: d4rmaa1, d4rmaa2, d4rmab1, d4rmab2
   automated match to d2zpya2
   complexed with so4

Details for d4rmaa3

PDB Entry: 4rma, 1.75 Å

PDB Description: crystal structure of the ferm domain of human ezrin

PDB Compounds: (A:) Ezrin

SCOPe Domain Sequences for d4rmaa3:

Sequence; same for both SEQRES and ATOM records:

>d4rmaa3 b.55.1.0 (A:199-296) automated matches {Human (Homo sapiens) [TaxId: 9606]}
emyginyfeiknkkgtdlwlgvdalglniyekddkltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilqlcmgnhelymrrrk

Timeline for d4rmaa3:

• d4rmaa3 is new in SCOPe 2.06-stable
  
• d4rmaa3 appears in SCOPe 2.07
  
• d4rmaa3 appears in the current release, SCOPe 2.08