SCOPe 2.07: Domain d4rh6c1: 4rh6 C:38-125

Lineage for d4rh6c1 (4rh6 C:38-125)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.0: automated matches [227133] (1 protein)
   not a true family

6. Protein automated matches [226834] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [225286] (4 PDB entries)

8. Domain d4rh6c1: 4rh6 C:38-125 [309428]
   Other proteins in same PDB: d4rh6a2, d4rh6b2, d4rh6c2
   automated match to d4o1nd1
   complexed with cl

Details for d4rh6c1

PDB Entry: 4rh6, 2.9 Å

PDB Description: 2.9 angstrom crystal structure of putative exotoxin 3 from staphylococcus aureus.

PDB Compounds: (C:) Exotoxin 3, putative

SCOPe Domain Sequences for d4rh6c1:

Sequence; same for both SEQRES and ATOM records:

>d4rh6c1 b.40.2.0 (C:38-125) automated matches {Staphylococcus aureus [TaxId: 93062]}
seselkhyynkpilerknvtgfkytdegkhylevtvgqqhsritllgsdkdkfkdgensn
idvfilregdsrqatnysiggvtksnsv

Timeline for d4rh6c1:

• d4rh6c1 first appeared in SCOPe 2.06
  
• d4rh6c1 appears in the current release, SCOPe 2.08