SCOPe 2.07: Domain d4rh6b2: 4rh6 B:126-226

Lineage for d4rh6b2 (4rh6 B:126-226)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.0: automated matches [227139] (1 protein)
   not a true family

6. Protein automated matches [226841] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [226095] (2 PDB entries)

8. Domain d4rh6b2: 4rh6 B:126-226 [309427]
   Other proteins in same PDB: d4rh6a1, d4rh6b1, d4rh6c1
   automated match to d4o1na2
   complexed with cl

Details for d4rh6b2

PDB Entry: 4rh6, 2.9 Å

PDB Description: 2.9 angstrom crystal structure of putative exotoxin 3 from staphylococcus aureus.

PDB Compounds: (B:) Exotoxin 3, putative

SCOPe Domain Sequences for d4rh6b2:

Sequence; same for both SEQRES and ATOM records:

>d4rh6b2 d.15.6.0 (B:126-226) automated matches {Staphylococcus aureus [TaxId: 93062]}
qyidyintpileikkdnedvlkdfyyiskedislkeldyrlreraikqhglysnglkqgq
ititmndgtthtidlsqklekermgesidgtkinkilvemk

Timeline for d4rh6b2:

• d4rh6b2 first appeared in SCOPe 2.06