SCOPe 2.06: Domain d4rh6a2: 4rh6 A:126-226

Lineage for d4rh6a2 (4rh6 A:126-226)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.0: automated matches [227139] (1 protein)
   not a true family

6. Protein automated matches [226841] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [226095] (2 PDB entries)

8. Domain d4rh6a2: 4rh6 A:126-226 [309425]
   Other proteins in same PDB: d4rh6a1, d4rh6b1, d4rh6c1
   automated match to d4o1na2
   complexed with cl

Details for d4rh6a2

PDB Entry: 4rh6, 2.9 Å

PDB Description: 2.9 angstrom crystal structure of putative exotoxin 3 from staphylococcus aureus.

PDB Compounds: (A:) Exotoxin 3, putative

SCOPe Domain Sequences for d4rh6a2:

Sequence, based on SEQRES records:

>d4rh6a2 d.15.6.0 (A:126-226) automated matches {Staphylococcus aureus [TaxId: 93062]}
qyidyintpileikkdnedvlkdfyyiskedislkeldyrlreraikqhglysnglkqgq
ititmndgtthtidlsqklekermgesidgtkinkilvemk

Sequence, based on observed residues (ATOM records):

>d4rh6a2 d.15.6.0 (A:126-226) automated matches {Staphylococcus aureus [TaxId: 93062]}
qyidyintpileikkddvlkdfyyiskedislkeldyrlreraikqhglysnglkqgqit
itmndgtthtidlsqklekermgesidgtkinkilvemk

Timeline for d4rh6a2:

• d4rh6a2 is new in SCOPe 2.06-stable
  
• d4rh6a2 appears in SCOPe 2.07
  
• d4rh6a2 appears in the current release, SCOPe 2.08