Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.0: automated matches [227133] (1 protein) not a true family |
Protein automated matches [226834] (6 species) not a true protein |
Species Staphylococcus aureus [TaxId:93062] [225286] (4 PDB entries) |
Domain d4rh6a1: 4rh6 A:38-125 [309424] Other proteins in same PDB: d4rh6a2, d4rh6b2, d4rh6c2 automated match to d4o1nd1 complexed with cl |
PDB Entry: 4rh6 (more details), 2.9 Å
SCOPe Domain Sequences for d4rh6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rh6a1 b.40.2.0 (A:38-125) automated matches {Staphylococcus aureus [TaxId: 93062]} seselkhyynkpilerknvtgfkytdegkhylevtvgqqhsritllgsdkdkfkdgensn idvfilregdsrqatnysiggvtksnsv
Timeline for d4rh6a1:
View in 3D Domains from other chains: (mouse over for more information) d4rh6b1, d4rh6b2, d4rh6c1, d4rh6c2 |