Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Human betacoronavirus 2c jordan-n3/2012 [TaxId:1306931] [311426] (3 PDB entries) |
Domain d4reza1: 4rez A:1484-1542 [309421] Other proteins in same PDB: d4reza2 automated match to d4p16a1 complexed with pgo, zn |
PDB Entry: 4rez (more details), 2.8 Å
SCOPe Domain Sequences for d4reza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4reza1 d.15.1.0 (A:1484-1542) automated matches {Human betacoronavirus 2c jordan-n3/2012 [TaxId: 1306931]} tievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladnlt
Timeline for d4reza1: