SCOPe 2.08: Domain d4r00c1: 4r00 C:1-234

Lineage for d4r00c1 (4r00 C:1-234)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (19 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)

8. Domain d4r00c1: 4r00 C:1-234 [309327]
   Other proteins in same PDB: d4r00a_, d4r00b_, d4r00c2, d4r00d_, d4r00e_, d4r00f_, d4r00g_, d4r00h_, d4r00i_, d4r00j_, d4r00k_, d4r00l_, d4r00m_, d4r00n_, d4r00o_, d4r00p_, d4r00q2, d4r00r_, d4r00s_, d4r00t_, d4r00u_, d4r00v_, d4r00w_, d4r00x_, d4r00y_, d4r00z_
   automated match to d4eu2a_
   complexed with cl, mg, sla; mutant

Details for d4r00c1

PDB Entry: 4r00, 2.8 Å

PDB Description: yCP beta5-C52F mutant in complex with Omuralide

PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4r00c1:

Sequence; same for both SEQRES and ATOM records:

>d4r00c1 d.153.1.0 (C:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

Timeline for d4r00c1:

• d4r00c1 first appeared in SCOPe 2.06, called d4r00c_
  
• d4r00c1 was called d4r00c_ in SCOPe 2.07