Lineage for d4qzzq1 (4qzz Q:1-234)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2995948Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)
  8. 2996022Domain d4qzzq1: 4qzz Q:1-234 [309316]
    Other proteins in same PDB: d4qzza_, d4qzzb_, d4qzzc2, d4qzzd_, d4qzze_, d4qzzf_, d4qzzg_, d4qzzh_, d4qzzi_, d4qzzj_, d4qzzk_, d4qzzl_, d4qzzm_, d4qzzn_, d4qzzo_, d4qzzp_, d4qzzq2, d4qzzr_, d4qzzs_, d4qzzt_, d4qzzu_, d4qzzv_, d4qzzw_, d4qzzx_, d4qzzy_, d4qzzz_
    automated match to d4eu2a_
    complexed with cl, mg, sla

Details for d4qzzq1

PDB Entry: 4qzz (more details), 2.9 Å

PDB Description: yCP in complex with Omuralide
PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qzzq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qzzq1 d.153.1.0 (Q:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

SCOPe Domain Coordinates for d4qzzq1:

Click to download the PDB-style file with coordinates for d4qzzq1.
(The format of our PDB-style files is described here.)

Timeline for d4qzzq1: