Lineage for d4qzxq_ (4qzx Q:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2230570Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2230571Protein automated matches [190509] (14 species)
    not a true protein
  7. 2230621Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2230645Domain d4qzxq_: 4qzx Q: [309292]
    Other proteins in same PDB: d4qzxa_, d4qzxb_, d4qzxe_, d4qzxf_, d4qzxg_, d4qzxh_, d4qzxi_, d4qzxj_, d4qzxk_, d4qzxl_, d4qzxm_, d4qzxn_, d4qzxo_, d4qzxp_, d4qzxs_, d4qzxt_, d4qzxu_, d4qzxv_, d4qzxw_, d4qzxx_, d4qzxy_, d4qzxz_
    automated match to d4eu2a_
    complexed with 04c, cl, mes, mg; mutant

Details for d4qzxq_

PDB Entry: 4qzx (more details), 2.6 Å

PDB Description: yCP beta5-C63F mutant in complex with the epoxyketone inhibitor ONX 0914
PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qzxq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qzxq_ d.153.1.0 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d4qzxq_:

Click to download the PDB-style file with coordinates for d4qzxq_.
(The format of our PDB-style files is described here.)

Timeline for d4qzxq_: