Lineage for d1dgtb3 (1dgt B:2582-2660)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 240704Fold c.15: BRCT domain [52112] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 240705Superfamily c.15.1: BRCT domain [52113] (4 families) (S)
  5. 240710Family c.15.1.2: DNA ligase [52117] (2 proteins)
  6. 240715Protein NAD+-dependent DNA ligase, domain 4 [52118] (1 species)
  7. 240716Species Thermus filiformis [TaxId:276] [52119] (1 PDB entry)
  8. 240717Domain d1dgtb3: 1dgt B:2582-2660 [30926]
    Other proteins in same PDB: d1dgta1, d1dgta2, d1dgta3, d1dgtb1, d1dgtb2, d1dgtb4
    less ordered in the crystal structure
    complexed with amp, zn

Details for d1dgtb3

PDB Entry: 1dgt (more details), 2.9 Å

PDB Description: crystal structure of nad+-dependent dna ligase

SCOP Domain Sequences for d1dgtb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgtb3 c.15.1.2 (B:2582-2660) NAD+-dependent DNA ligase, domain 4 {Thermus filiformis}
eevsdllsgltfvltgelsrpreevkallgrlgakvtdsvsrktsylvvgenpgskleka
ralgvavlteeefwrflke

SCOP Domain Coordinates for d1dgtb3:

Click to download the PDB-style file with coordinates for d1dgtb3.
(The format of our PDB-style files is described here.)

Timeline for d1dgtb3: