Lineage for d1dgtb3 (1dgt B:2582-2660)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67929Fold c.15: BRCT domain [52112] (1 superfamily)
  4. 67930Superfamily c.15.1: BRCT domain [52113] (3 families) (S)
  5. 67935Family c.15.1.2: DNA ligase [52117] (2 proteins)
  6. 67940Protein NAD+-dependent DNA ligase, domain 4 [52118] (1 species)
  7. 67941Species Thermus filiformis [TaxId:276] [52119] (1 PDB entry)
  8. 67942Domain d1dgtb3: 1dgt B:2582-2660 [30926]
    Other proteins in same PDB: d1dgta1, d1dgta2, d1dgta3, d1dgtb1, d1dgtb2, d1dgtb4

Details for d1dgtb3

PDB Entry: 1dgt (more details), 2.9 Å

PDB Description: crystal structure of nad+-dependent dna ligase

SCOP Domain Sequences for d1dgtb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgtb3 c.15.1.2 (B:2582-2660) NAD+-dependent DNA ligase, domain 4 {Thermus filiformis}
eevsdllsgltfvltgelsrpreevkallgrlgakvtdsvsrktsylvvgenpgskleka
ralgvavlteeefwrflke

SCOP Domain Coordinates for d1dgtb3:

Click to download the PDB-style file with coordinates for d1dgtb3.
(The format of our PDB-style files is described here.)

Timeline for d1dgtb3: