Lineage for d4qz7n_ (4qz7 N:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2226421Protein Proteasome beta subunit (catalytic) [56252] (6 species)
  7. 2226430Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (174 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2227095Domain d4qz7n_: 4qz7 N: [309233]
    Other proteins in same PDB: d4qz7b_, d4qz7c_, d4qz7e_, d4qz7f_, d4qz7g_, d4qz7h_, d4qz7k_, d4qz7m_, d4qz7p_, d4qz7q_, d4qz7s_, d4qz7t_, d4qz7u_, d4qz7v_, d4qz7y_
    automated match to d1g0un_
    complexed with 04c, cl, mes, mg; mutant

Details for d4qz7n_

PDB Entry: 4qz7 (more details), 2.8 Å

PDB Description: yCP beta5-A50V mutant in complex with the epoxyketone inhibitor ONX 0914
PDB Compounds: (N:) Proteasome subunit beta type-1

SCOPe Domain Sequences for d4qz7n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qz7n_ d.153.1.4 (N:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
agverlifypdeyeql

SCOPe Domain Coordinates for d4qz7n_:

Click to download the PDB-style file with coordinates for d4qz7n_.
(The format of our PDB-style files is described here.)

Timeline for d4qz7n_: