Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
Domain d4qz6p_: 4qz6 P: [309211] Other proteins in same PDB: d4qz6a_, d4qz6c_, d4qz6e_, d4qz6g_, d4qz6i_, d4qz6j_, d4qz6k_, d4qz6l_, d4qz6n_, d4qz6o_, d4qz6q_, d4qz6s_, d4qz6u_, d4qz6w_, d4qz6x_, d4qz6y_, d4qz6z_ automated match to d1rypc_ complexed with 04c, cl, mes, mg; mutant |
PDB Entry: 4qz6 (more details), 2.9 Å
SCOPe Domain Sequences for d4qz6p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qz6p_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d4qz6p_: