Lineage for d4qz4g_ (4qz4 G:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2229205Domain d4qz4g_: 4qz4 G: [309154]
    Other proteins in same PDB: d4qz4a_, d4qz4c_, d4qz4e_, d4qz4i_, d4qz4j_, d4qz4k_, d4qz4l_, d4qz4n_, d4qz4o_, d4qz4q_, d4qz4s_, d4qz4w_, d4qz4x_, d4qz4y_, d4qz4z_
    automated match to d1rypa_
    complexed with 04c, cl, mes, mg; mutant

Details for d4qz4g_

PDB Entry: 4qz4 (more details), 3 Å

PDB Description: yCP beta5-A49S mutant in complex with the epoxyketone inhibitor ONX 0914
PDB Compounds: (G:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d4qz4g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qz4g_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

SCOPe Domain Coordinates for d4qz4g_:

Click to download the PDB-style file with coordinates for d4qz4g_.
(The format of our PDB-style files is described here.)

Timeline for d4qz4g_: