Lineage for d4qz1h_ (4qz1 H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994025Domain d4qz1h_: 4qz1 H: [309083]
    Other proteins in same PDB: d4qz1a_, d4qz1c1, d4qz1c2, d4qz1e_, d4qz1i_, d4qz1j_, d4qz1k_, d4qz1l_, d4qz1n_, d4qz1o_, d4qz1q1, d4qz1q2, d4qz1s_, d4qz1w_, d4qz1x_, d4qz1y_, d4qz1z_
    automated match to d4r17h_
    complexed with 04c, cl, mes, mg; mutant

Details for d4qz1h_

PDB Entry: 4qz1 (more details), 3 Å

PDB Description: yCP beta5-M45T mutant in complex with the epoxyketone inhibitor ONX 0914
PDB Compounds: (H:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d4qz1h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qz1h_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

SCOPe Domain Coordinates for d4qz1h_:

Click to download the PDB-style file with coordinates for d4qz1h_.
(The format of our PDB-style files is described here.)

Timeline for d4qz1h_: