Lineage for d4qz0f_ (4qz0 F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2993928Domain d4qz0f_: 4qz0 F: [309057]
    Other proteins in same PDB: d4qz0a_, d4qz0c1, d4qz0c2, d4qz0e_, d4qz0i_, d4qz0j_, d4qz0k_, d4qz0l_, d4qz0n_, d4qz0o_, d4qz0q1, d4qz0q2, d4qz0s_, d4qz0w_, d4qz0x_, d4qz0y_, d4qz0z_
    automated match to d4g4sg_
    complexed with 04c, cl, mes, mg; mutant

Details for d4qz0f_

PDB Entry: 4qz0 (more details), 3 Å

PDB Description: yCP beta5-M45V mutant in complex with the epoxyketone inhibitor ONX 0914
PDB Compounds: (F:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4qz0f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qz0f_ d.153.1.4 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d4qz0f_:

Click to download the PDB-style file with coordinates for d4qz0f_.
(The format of our PDB-style files is described here.)

Timeline for d4qz0f_: