Lineage for d4qxul1 (4qxu L:1-112)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024733Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries)
  8. 2024945Domain d4qxul1: 4qxu L:1-112 [309051]
    Other proteins in same PDB: d4qxul2
    automated match to d1blna1
    complexed with so4

Details for d4qxul1

PDB Entry: 4qxu (more details), 2.3 Å

PDB Description: Novel Inhibition Mechanism of Membrane Metalloprotease by an Exosite-Swiveling Conformational antibody
PDB Compounds: (L:) anti_MT1-MMP light chain

SCOPe Domain Sequences for d4qxul1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qxul1 b.1.1.1 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqtplslpvglgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshapytfgggtkleik

SCOPe Domain Coordinates for d4qxul1:

Click to download the PDB-style file with coordinates for d4qxul1.
(The format of our PDB-style files is described here.)

Timeline for d4qxul1: