Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d4qxjb_: 4qxj B: [309028] Other proteins in same PDB: d4qxja_, d4qxjc1, d4qxjc2, d4qxjd_, d4qxje_, d4qxjg_, d4qxji_, d4qxjj_, d4qxjk_, d4qxjl_, d4qxjn_, d4qxjo_, d4qxjq1, d4qxjq2, d4qxjr_, d4qxjs_, d4qxju_, d4qxjw_, d4qxjx_, d4qxjy_, d4qxjz_ automated match to d1rypc_ complexed with 04c, cl, mes, mg; mutant |
PDB Entry: 4qxj (more details), 2.8 Å
SCOPe Domain Sequences for d4qxjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qxjb_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d4qxjb_:
View in 3D Domains from other chains: (mouse over for more information) d4qxja_, d4qxjc1, d4qxjc2, d4qxjd_, d4qxje_, d4qxjf_, d4qxjg_, d4qxjh_, d4qxji_, d4qxjj_, d4qxjk_, d4qxjl_, d4qxjm_, d4qxjn_, d4qxjo_, d4qxjp_, d4qxjq1, d4qxjq2, d4qxjr_, d4qxjs_, d4qxjt_, d4qxju_, d4qxjv_, d4qxjw_, d4qxjx_, d4qxjy_, d4qxjz_ |