Lineage for d4qxjb_ (4qxj B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2993855Domain d4qxjb_: 4qxj B: [309028]
    Other proteins in same PDB: d4qxja_, d4qxjc1, d4qxjc2, d4qxjd_, d4qxje_, d4qxjg_, d4qxji_, d4qxjj_, d4qxjk_, d4qxjl_, d4qxjn_, d4qxjo_, d4qxjq1, d4qxjq2, d4qxjr_, d4qxjs_, d4qxju_, d4qxjw_, d4qxjx_, d4qxjy_, d4qxjz_
    automated match to d1rypc_
    complexed with 04c, cl, mes, mg; mutant

Details for d4qxjb_

PDB Entry: 4qxj (more details), 2.8 Å

PDB Description: yCP beta5-M45A mutant in complex with the epoxyketone inhibitor ONX 0914
PDB Compounds: (B:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d4qxjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qxjb_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d4qxjb_:

Click to download the PDB-style file with coordinates for d4qxjb_.
(The format of our PDB-style files is described here.)

Timeline for d4qxjb_: