Lineage for d1fcfa2 (1fcf A:253-463)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21544Fold c.14: ClpP/crotonase [52095] (1 superfamily)
  4. 21545Superfamily c.14.1: ClpP/crotonase [52096] (3 families) (S)
  5. 21563Family c.14.1.2: Photosystem II D1 C-terminal processing protease, catalytic domain [52100] (1 protein)
  6. 21564Protein Photosystem II D1 C-terminal processing protease, catalytic domain [52101] (1 species)
  7. 21565Species Algae (Scenedesmus obliquus) [TaxId:3088] [52102] (4 PDB entries)
  8. 21569Domain d1fcfa2: 1fcf A:253-463 [30902]
    Other proteins in same PDB: d1fcfa1

Details for d1fcfa2

PDB Entry: 1fcf (more details), 2.1 Å

PDB Description: photosystem ii d1 c-terminal processing protease

SCOP Domain Sequences for d1fcfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcfa2 c.14.1.2 (A:253-463) Photosystem II D1 C-terminal processing protease, catalytic domain {Algae (Scenedesmus obliquus)}
npvtfttcsnvaaaalppgaakqqlgyvrlatfnsnttaaaqqaftelskqgvaglvldi
rnnggglfpagvnvarmlvdrgdlvliadsqgirdiysadgnsidsatplvvlvnrgtas
asevlagalkdskrgliagertfgkgliqtvvdlsdgsgvavtvaryqtpagvdinkigv
spdvqldpevlptdlegvcrvlgsdaaprlf

SCOP Domain Coordinates for d1fcfa2:

Click to download the PDB-style file with coordinates for d1fcfa2.
(The format of our PDB-style files is described here.)

Timeline for d1fcfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fcfa1