Lineage for d4qwxt_ (4qwx T:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2993811Domain d4qwxt_: 4qwx T: [309018]
    Other proteins in same PDB: d4qwxa_, d4qwxc1, d4qwxc2, d4qwxd_, d4qwxe_, d4qwxg_, d4qwxi_, d4qwxj_, d4qwxk_, d4qwxl_, d4qwxn_, d4qwxo_, d4qwxq1, d4qwxq2, d4qwxr_, d4qwxs_, d4qwxu_, d4qwxw_, d4qwxx_, d4qwxy_, d4qwxz_
    automated match to d4g4sg_
    complexed with 04c, cl, mes, mg, na

Details for d4qwxt_

PDB Entry: 4qwx (more details), 2.9 Å

PDB Description: yCP in complex with the epoxyketone inhibitor ONX 0914
PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4qwxt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qwxt_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d4qwxt_:

Click to download the PDB-style file with coordinates for d4qwxt_.
(The format of our PDB-style files is described here.)

Timeline for d4qwxt_: