Lineage for d4qwxq_ (4qwx Q:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2230570Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2230571Protein automated matches [190509] (14 species)
    not a true protein
  7. 2230621Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2230663Domain d4qwxq_: 4qwx Q: [309016]
    Other proteins in same PDB: d4qwxa_, d4qwxb_, d4qwxe_, d4qwxf_, d4qwxg_, d4qwxh_, d4qwxi_, d4qwxj_, d4qwxk_, d4qwxl_, d4qwxm_, d4qwxn_, d4qwxo_, d4qwxp_, d4qwxs_, d4qwxt_, d4qwxu_, d4qwxv_, d4qwxw_, d4qwxx_, d4qwxy_, d4qwxz_
    automated match to d4eu2a_
    complexed with 04c, cl, mes, mg, na

Details for d4qwxq_

PDB Entry: 4qwx (more details), 2.9 Å

PDB Description: yCP in complex with the epoxyketone inhibitor ONX 0914
PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qwxq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qwxq_ d.153.1.0 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d4qwxq_:

Click to download the PDB-style file with coordinates for d4qwxq_.
(The format of our PDB-style files is described here.)

Timeline for d4qwxq_: