Lineage for d1fc9a2 (1fc9 A:253-463)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67869Fold c.14: ClpP/crotonase [52095] (1 superfamily)
  4. 67870Superfamily c.14.1: ClpP/crotonase [52096] (3 families) (S)
  5. 67888Family c.14.1.2: Photosystem II D1 C-terminal processing protease, catalytic domain [52100] (1 protein)
  6. 67889Protein Photosystem II D1 C-terminal processing protease, catalytic domain [52101] (1 species)
  7. 67890Species Algae (Scenedesmus obliquus) [TaxId:3088] [52102] (4 PDB entries)
  8. 67893Domain d1fc9a2: 1fc9 A:253-463 [30901]
    Other proteins in same PDB: d1fc9a1

Details for d1fc9a2

PDB Entry: 1fc9 (more details), 1.9 Å

PDB Description: photosystem ii d1 c-terminal processing protease

SCOP Domain Sequences for d1fc9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fc9a2 c.14.1.2 (A:253-463) Photosystem II D1 C-terminal processing protease, catalytic domain {Algae (Scenedesmus obliquus)}
npvtfttcsnvaaaalppgaakqqlgyvrlatfnsnttaaaqqaftelskqgvaglvldi
rnnggglfpagvnvarmlvdrgdlvliadsqgirdiysadgnsidsatplvvlvnrgtas
asevlagalkdskrgliagertfgkgliqtvvdlsdgsgvavtvaryqtpagvdinkigv
spdvqldpevlptdlegvcrvlgsdaaprlf

SCOP Domain Coordinates for d1fc9a2:

Click to download the PDB-style file with coordinates for d1fc9a2.
(The format of our PDB-style files is described here.)

Timeline for d1fc9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fc9a1