Lineage for d4qwuu_ (4qwu U:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994107Domain d4qwuu_: 4qwu U: [308995]
    Other proteins in same PDB: d4qwua_, d4qwuc1, d4qwuc2, d4qwue_, d4qwui_, d4qwuj_, d4qwuk_, d4qwul_, d4qwun_, d4qwuo_, d4qwuq1, d4qwuq2, d4qwus_, d4qwuw_, d4qwux_, d4qwuy_, d4qwuz_
    automated match to d1rypa_
    complexed with bo2, cl, mg; mutant

Details for d4qwuu_

PDB Entry: 4qwu (more details), 3 Å

PDB Description: yCP beta5-C52F mutant in complex with bortezomib
PDB Compounds: (U:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d4qwuu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qwuu_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

SCOPe Domain Coordinates for d4qwuu_:

Click to download the PDB-style file with coordinates for d4qwuu_.
(The format of our PDB-style files is described here.)

Timeline for d4qwuu_: