Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d4qwup_: 4qwu P: [308991] Other proteins in same PDB: d4qwua_, d4qwuc1, d4qwuc2, d4qwue_, d4qwui_, d4qwuj_, d4qwuk_, d4qwul_, d4qwun_, d4qwuo_, d4qwuq1, d4qwuq2, d4qwus_, d4qwuw_, d4qwux_, d4qwuy_, d4qwuz_ automated match to d1rypc_ complexed with bo2, cl, mg; mutant |
PDB Entry: 4qwu (more details), 3 Å
SCOPe Domain Sequences for d4qwup_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qwup_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d4qwup_: