Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein Clp protease, ClpP subunit [52098] (11 species) |
Species Escherichia coli [TaxId:562] [52099] (2 PDB entries) |
Domain d1tyfl_: 1tyf L: [30896] |
PDB Entry: 1tyf (more details), 2.3 Å
SCOPe Domain Sequences for d1tyfl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tyfl_ c.14.1.1 (L:) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} srgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvi tagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqg qatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilt hrn
Timeline for d1tyfl_: