Lineage for d4qwsh_ (4qws H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2993991Domain d4qwsh_: 4qws H: [308959]
    Other proteins in same PDB: d4qwsa_, d4qwsc1, d4qwsc2, d4qwse_, d4qwsi_, d4qwsj_, d4qwsk_, d4qwsl_, d4qwsn_, d4qwso_, d4qwsq1, d4qwsq2, d4qwss_, d4qwsw_, d4qwsx_, d4qwsy_, d4qwsz_
    automated match to d4r17h_
    complexed with 3bv, cl, mes, mg; mutant

Details for d4qwsh_

PDB Entry: 4qws (more details), 3 Å

PDB Description: yCP beta5-C63F mutant in complex with carfilzomib
PDB Compounds: (H:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d4qwsh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qwsh_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

SCOPe Domain Coordinates for d4qwsh_:

Click to download the PDB-style file with coordinates for d4qwsh_.
(The format of our PDB-style files is described here.)

Timeline for d4qwsh_: