Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
Domain d4qwrp_: 4qwr P: [308943] Other proteins in same PDB: d4qwra_, d4qwrc_, d4qwre_, d4qwrg_, d4qwri_, d4qwrj_, d4qwrk_, d4qwrl_, d4qwrn_, d4qwro_, d4qwrq_, d4qwrs_, d4qwru_, d4qwrw_, d4qwrx_, d4qwry_, d4qwrz_ automated match to d1rypc_ complexed with 3bv, cl, mes, mg; mutant |
PDB Entry: 4qwr (more details), 2.9 Å
SCOPe Domain Sequences for d4qwrp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qwrp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d4qwrp_: