Lineage for d4qwrm_ (4qwr M:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2993939Domain d4qwrm_: 4qwr M: [308940]
    Other proteins in same PDB: d4qwra_, d4qwrc1, d4qwrc2, d4qwrd_, d4qwre_, d4qwrg_, d4qwri_, d4qwrj_, d4qwrk_, d4qwrl_, d4qwrn_, d4qwro_, d4qwrq1, d4qwrq2, d4qwrr_, d4qwrs_, d4qwru_, d4qwrw_, d4qwrx_, d4qwry_, d4qwrz_
    automated match to d4j70m_
    complexed with 3bv, cl, mes, mg; mutant

Details for d4qwrm_

PDB Entry: 4qwr (more details), 2.9 Å

PDB Description: yCP beta5-C52F mutant in complex with carfilzomib
PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d4qwrm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qwrm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOPe Domain Coordinates for d4qwrm_:

Click to download the PDB-style file with coordinates for d4qwrm_.
(The format of our PDB-style files is described here.)

Timeline for d4qwrm_: