SCOPe 2.06: Domain d4qwkx_: 4qwk X:

Lineage for d4qwkx_ (4qwk X:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (174 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d4qwkx_: 4qwk X: [308902]
   Other proteins in same PDB: d4qwkb_, d4qwkc_, d4qwke_, d4qwkf_, d4qwkg_, d4qwkh_, d4qwkk_, d4qwkm_, d4qwkp_, d4qwkq_, d4qwks_, d4qwkt_, d4qwku_, d4qwkv_, d4qwky_
   automated match to d1rypk_
   complexed with 3bv, cl, mes, mg; mutant

Details for d4qwkx_

PDB Entry: 4qwk, 2.8 Å

PDB Description: yCP beta5-A49T-A50V-double mutant in complex with carfilzomib

PDB Compounds: (X:) Proteasome subunit beta type-4

SCOPe Domain Sequences for d4qwkx_:

Sequence; same for both SEQRES and ATOM records:

>d4qwkx_ d.153.1.4 (X:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
vkivdkdgirqvddf

Timeline for d4qwkx_:

• d4qwkx_ is new in SCOPe 2.06-stable
  
• d4qwkx_ appears in SCOPe 2.07
  
• d4qwkx_ appears in the current release, SCOPe 2.08