Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries) |
Domain d4qwkq_: 4qwk Q: [308896] Other proteins in same PDB: d4qwka_, d4qwkb_, d4qwke_, d4qwkf_, d4qwkg_, d4qwkh_, d4qwki_, d4qwkj_, d4qwkk_, d4qwkl_, d4qwkm_, d4qwkn_, d4qwko_, d4qwkp_, d4qwks_, d4qwkt_, d4qwku_, d4qwkv_, d4qwkw_, d4qwkx_, d4qwky_, d4qwkz_ automated match to d4eu2a_ complexed with 3bv, cl, mes, mg; mutant |
PDB Entry: 4qwk (more details), 2.8 Å
SCOPe Domain Sequences for d4qwkq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qwkq_ d.153.1.0 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d4qwkq_: