Lineage for d4qwkc1 (4qwk C:1-234)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2995948Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)
  8. 2995985Domain d4qwkc1: 4qwk C:1-234 [308883]
    Other proteins in same PDB: d4qwka_, d4qwkb_, d4qwkc2, d4qwkd_, d4qwke_, d4qwkf_, d4qwkg_, d4qwkh_, d4qwki_, d4qwkj_, d4qwkk_, d4qwkl_, d4qwkm_, d4qwkn_, d4qwko_, d4qwkp_, d4qwkq2, d4qwkr_, d4qwks_, d4qwkt_, d4qwku_, d4qwkv_, d4qwkw_, d4qwkx_, d4qwky_, d4qwkz_
    automated match to d4eu2a_
    complexed with 3bv, cl, mes, mg; mutant

Details for d4qwkc1

PDB Entry: 4qwk (more details), 2.8 Å

PDB Description: yCP beta5-A49T-A50V-double mutant in complex with carfilzomib
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qwkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qwkc1 d.153.1.0 (C:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

SCOPe Domain Coordinates for d4qwkc1:

Click to download the PDB-style file with coordinates for d4qwkc1.
(The format of our PDB-style files is described here.)

Timeline for d4qwkc1: