Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d4qwkb_: 4qwk B: [308882] Other proteins in same PDB: d4qwka_, d4qwkc1, d4qwkc2, d4qwkd_, d4qwke_, d4qwkg_, d4qwki_, d4qwkj_, d4qwkk_, d4qwkl_, d4qwkn_, d4qwko_, d4qwkq1, d4qwkq2, d4qwkr_, d4qwks_, d4qwku_, d4qwkw_, d4qwkx_, d4qwky_, d4qwkz_ automated match to d1rypc_ complexed with 3bv, cl, mes, mg; mutant |
PDB Entry: 4qwk (more details), 2.8 Å
SCOPe Domain Sequences for d4qwkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qwkb_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d4qwkb_:
View in 3D Domains from other chains: (mouse over for more information) d4qwka_, d4qwkc1, d4qwkc2, d4qwkd_, d4qwke_, d4qwkf_, d4qwkg_, d4qwkh_, d4qwki_, d4qwkj_, d4qwkk_, d4qwkl_, d4qwkm_, d4qwkn_, d4qwko_, d4qwkp_, d4qwkq1, d4qwkq2, d4qwkr_, d4qwks_, d4qwkt_, d4qwku_, d4qwkv_, d4qwkw_, d4qwkx_, d4qwky_, d4qwkz_ |