Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
Domain d4qwiv_: 4qwi V: [308852] Other proteins in same PDB: d4qwia_, d4qwic_, d4qwie_, d4qwig_, d4qwii_, d4qwij_, d4qwik_, d4qwil_, d4qwin_, d4qwio_, d4qwiq_, d4qwis_, d4qwiu_, d4qwiw_, d4qwix_, d4qwiy_, d4qwiz_ automated match to d4r17h_ complexed with 3bv, cl, mes, mg; mutant |
PDB Entry: 4qwi (more details), 2.6 Å
SCOPe Domain Sequences for d4qwiv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qwiv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
Timeline for d4qwiv_: