Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d4qwgb_: 4qwg B: [308810] Other proteins in same PDB: d4qwga_, d4qwgc1, d4qwgc2, d4qwgd_, d4qwge_, d4qwgg_, d4qwgi_, d4qwgj_, d4qwgk_, d4qwgl_, d4qwgn_, d4qwgo_, d4qwgq1, d4qwgq2, d4qwgr_, d4qwgs_, d4qwgu_, d4qwgw_, d4qwgx_, d4qwgy_, d4qwgz_ automated match to d1rypc_ complexed with 3bv, cl, mes, mg; mutant |
PDB Entry: 4qwg (more details), 2.6 Å
SCOPe Domain Sequences for d4qwgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qwgb_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d4qwgb_:
View in 3D Domains from other chains: (mouse over for more information) d4qwga_, d4qwgc1, d4qwgc2, d4qwgd_, d4qwge_, d4qwgf_, d4qwgg_, d4qwgh_, d4qwgi_, d4qwgj_, d4qwgk_, d4qwgl_, d4qwgm_, d4qwgn_, d4qwgo_, d4qwgp_, d4qwgq1, d4qwgq2, d4qwgr_, d4qwgs_, d4qwgt_, d4qwgu_, d4qwgv_, d4qwgw_, d4qwgx_, d4qwgy_, d4qwgz_ |