Lineage for d4qwfm_ (4qwf M:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994001Domain d4qwfm_: 4qwf M: [308796]
    Other proteins in same PDB: d4qwfa_, d4qwfc1, d4qwfc2, d4qwfe_, d4qwfi_, d4qwfj_, d4qwfk_, d4qwfl_, d4qwfn_, d4qwfo_, d4qwfq1, d4qwfq2, d4qwfs_, d4qwfw_, d4qwfx_, d4qwfy_, d4qwfz_
    automated match to d4j70m_
    complexed with 3bv, cl, mes, mg; mutant

Details for d4qwfm_

PDB Entry: 4qwf (more details), 3 Å

PDB Description: yCP beta5-M45I mutant in complex with carfilzomib
PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d4qwfm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qwfm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOPe Domain Coordinates for d4qwfm_:

Click to download the PDB-style file with coordinates for d4qwfm_.
(The format of our PDB-style files is described here.)

Timeline for d4qwfm_: