Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries) |
Domain d4qw7c1: 4qw7 C:1-234 [308763] Other proteins in same PDB: d4qw7a_, d4qw7b_, d4qw7c2, d4qw7d_, d4qw7e_, d4qw7f_, d4qw7g_, d4qw7h_, d4qw7i_, d4qw7j_, d4qw7k_, d4qw7l_, d4qw7m_, d4qw7n_, d4qw7o_, d4qw7p_, d4qw7q2, d4qw7r_, d4qw7s_, d4qw7t_, d4qw7u_, d4qw7v_, d4qw7w_, d4qw7x_, d4qw7y_, d4qw7z_ automated match to d4eu2a_ complexed with 3bv, cl, mes, mg; mutant |
PDB Entry: 4qw7 (more details), 2.7 Å
SCOPe Domain Sequences for d4qw7c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qw7c1 d.153.1.0 (C:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi
Timeline for d4qw7c1:
View in 3D Domains from other chains: (mouse over for more information) d4qw7a_, d4qw7b_, d4qw7d_, d4qw7e_, d4qw7f_, d4qw7g_, d4qw7h_, d4qw7i_, d4qw7j_, d4qw7k_, d4qw7l_, d4qw7m_, d4qw7n_, d4qw7o_, d4qw7p_, d4qw7q1, d4qw7q2, d4qw7r_, d4qw7s_, d4qw7t_, d4qw7u_, d4qw7v_, d4qw7w_, d4qw7x_, d4qw7y_, d4qw7z_ |