![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N |
![]() | Superfamily c.10.2: L domain-like [52058] (7 families) ![]() less regular structure consisting of variable repeats |
![]() | Family c.10.2.4: U2A'-like [52068] (1 protein) duplication: consists of 5-6 partly irregular repeats |
![]() | Protein Splicesomal U2A' protein [52069] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52070] (1 PDB entry) |
![]() | Domain d1a9na_: 1a9n A: [30875] Other proteins in same PDB: d1a9nb_, d1a9nd_ |
PDB Entry: 1a9n (more details), 2.38 Å
SCOP Domain Sequences for d1a9na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens)} vkltaelieqaaqytnavrdreldlrgykipvienlgatldqfdaidfsdneirkldgfp llrrlktllvnnnricrigegldqalpdlteliltnnslvelgdldplaslksltylcil rnpvtnkkhyrlyviykvpqvrvldfqkvklkerqeaekmfk
Timeline for d1a9na_: