Lineage for d1ft8d_ (1ft8 D:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 240418Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N
  4. 240457Superfamily c.10.2: L domain-like [52058] (7 families) (S)
    less regular structure consisting of variable repeats
  5. 240478Family c.10.2.3: mRNA export factor tap [52065] (1 protein)
    this is a repeat family; one repeat unit is 1fo1 A:248-278 found in domain
  6. 240479Protein mRNA export factor tap [52066] (1 species)
  7. 240480Species Human (Homo sapiens) [TaxId:9606] [52067] (4 PDB entries)
  8. 240494Domain d1ft8d_: 1ft8 D: [30874]
    Other proteins in same PDB: d1ft8a2, d1ft8c2, d1ft8e_
    mutant

Details for d1ft8d_

PDB Entry: 1ft8 (more details), 3.15 Å

PDB Description: crystal structure of the rna-binding domain of the mrna export factor tap

SCOP Domain Sequences for d1ft8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ft8d_ c.10.2.3 (D:) mRNA export factor tap {Human (Homo sapiens)}
lkpeqveqlklimskrydgsqqvldlkglrsdpdlvaqnidvvlnrrscmaatlriieen
ipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleelwld
gnslcdtfrdqstyisairerfpkllrldghelpppiafdve

SCOP Domain Coordinates for d1ft8d_:

Click to download the PDB-style file with coordinates for d1ft8d_.
(The format of our PDB-style files is described here.)

Timeline for d1ft8d_: