Lineage for d4qw5q_ (4qw5 Q:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2230570Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2230571Protein automated matches [190509] (14 species)
    not a true protein
  7. 2230621Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2230701Domain d4qw5q_: 4qw5 Q: [308728]
    Other proteins in same PDB: d4qw5a_, d4qw5b_, d4qw5e_, d4qw5f_, d4qw5g_, d4qw5h_, d4qw5i_, d4qw5j_, d4qw5k_, d4qw5l_, d4qw5m_, d4qw5n_, d4qw5o_, d4qw5p_, d4qw5s_, d4qw5t_, d4qw5u_, d4qw5v_, d4qw5w_, d4qw5x_, d4qw5y_, d4qw5z_
    automated match to d4eu2a_
    complexed with 3bv, cl, mes, mg; mutant

Details for d4qw5q_

PDB Entry: 4qw5 (more details), 3 Å

PDB Description: yCP beta5-M45A mutant in complex with carfilzomib
PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qw5q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qw5q_ d.153.1.0 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d4qw5q_:

Click to download the PDB-style file with coordinates for d4qw5q_.
(The format of our PDB-style files is described here.)

Timeline for d4qw5q_: