Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d4qw5g_: 4qw5 G: [308718] Other proteins in same PDB: d4qw5a_, d4qw5c1, d4qw5c2, d4qw5e_, d4qw5i_, d4qw5j_, d4qw5k_, d4qw5l_, d4qw5n_, d4qw5o_, d4qw5q1, d4qw5q2, d4qw5s_, d4qw5w_, d4qw5x_, d4qw5y_, d4qw5z_ automated match to d1rypa_ complexed with 3bv, cl, mes, mg; mutant |
PDB Entry: 4qw5 (more details), 3 Å
SCOPe Domain Sequences for d4qw5g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qw5g_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae q
Timeline for d4qw5g_: