Lineage for d4qw5g_ (4qw5 G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2993945Domain d4qw5g_: 4qw5 G: [308718]
    Other proteins in same PDB: d4qw5a_, d4qw5c1, d4qw5c2, d4qw5e_, d4qw5i_, d4qw5j_, d4qw5k_, d4qw5l_, d4qw5n_, d4qw5o_, d4qw5q1, d4qw5q2, d4qw5s_, d4qw5w_, d4qw5x_, d4qw5y_, d4qw5z_
    automated match to d1rypa_
    complexed with 3bv, cl, mes, mg; mutant

Details for d4qw5g_

PDB Entry: 4qw5 (more details), 3 Å

PDB Description: yCP beta5-M45A mutant in complex with carfilzomib
PDB Compounds: (G:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d4qw5g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qw5g_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

SCOPe Domain Coordinates for d4qw5g_:

Click to download the PDB-style file with coordinates for d4qw5g_.
(The format of our PDB-style files is described here.)

Timeline for d4qw5g_: