Lineage for d4qw4p_ (4qw4 P:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2993852Domain d4qw4p_: 4qw4 P: [308703]
    Other proteins in same PDB: d4qw4a_, d4qw4c1, d4qw4c2, d4qw4d_, d4qw4e_, d4qw4g_, d4qw4i_, d4qw4j_, d4qw4k_, d4qw4l_, d4qw4n_, d4qw4o_, d4qw4q1, d4qw4q2, d4qw4r_, d4qw4s_, d4qw4u_, d4qw4w_, d4qw4x_, d4qw4y_, d4qw4z_
    automated match to d1rypc_
    complexed with 3bv, cl, mes, mg

Details for d4qw4p_

PDB Entry: 4qw4 (more details), 2.8 Å

PDB Description: yCP in complex with carfilzomib
PDB Compounds: (P:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d4qw4p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qw4p_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d4qw4p_:

Click to download the PDB-style file with coordinates for d4qw4p_.
(The format of our PDB-style files is described here.)

Timeline for d4qw4p_: